PsiMP glycosidase
€790.00
Price excl. shipping costs excl. VAT. For more information, see our shipping policy
SKU: P2020-109 trenzyme
Description
The PsiMP glycosidase biologically has a cleavage function and catalyzes the reversible cleavage of the C-C glycoside bond to form ribose-5-phosphate and uracil. PsiMP glycosidase, together with the enzyme pseudouridine kinase, is responsible for the degradation of pseudouridine in E. coli.
Overview
-
Product Name: PsiMP glycosidase
- Catalog No.: P2020-109
- RefSeq Links: UniProt: P33025
- Synonyms: Pseudouridine 5’-phosphate glycosidase; PsiMP glycosidase
Sequence Information
- Species: Escherichia coli; Salmonella sp. HNK130
- Tags: His-Tag, N-terminal
-
Sequence without tags (AA 1-312):
MSELKISPELLQISPEVQDALKNKKPVVALESTIISHGMPF
PQNAQTAIEVEETIRKQGAVPATIAIIGGVMKVGLSKEEIELLGREGHNVTKVSRRDLPF
VVAAGKNGATTVASTMIIAALAGIKVFATGGIGGVHRGAEHTFDISADLQELANTNVTVV
CAGAKSILDLGLTTEYLETFGVPLIGYQTKALPAFFCRTSPFDVSIRLDSASEIARAMVV
KWQSGLNGGLVVANPIPEQFAMPEHTINAAIDQAVAEAEAQGVIGKESTPFLLARVAELT
GGDSLKSNIQLVFNNAILASEIAKEYQRLAG
Product Information
- Expression Host: E. coli
- Formulation: PBS, pH 7,4
- Format: Liquid, stored and shipped at -80°C
- Purity: > 95% as determined by SDS-PAGE
Background Information
The enzymes PsiMP glycosidase and pseudouridine kinase are encoded by separate genes in bacterial genomes. PsiMP glycosidase is encoded by the yeiN gene, and pseudouridine kinase is encoded by the yeiC gene. Both genes belong to the same operon. In humans and other higher organisms, pseudouridine kinase and PsiMP glycosidase are not found. However, they are present in some eukaryotes as the only bifunctional enzymes.
In the process of pseudouridine degradation, when pseudouridine kinase phosphorylates pseudouridine, pseudouridine 5'-phosphate (PsiMP) is formed as a degradation product of RNAs. PsiMP is a non-classical nucleoside that has a glycosidic C-C bond and is present in human urine.
SDS-PAGE/Coll. Coomassie |
Histogram of marked lane in gel picture |