human PD-L1, His-Tag
€320.00
Price excl. shipping costs excl. VAT. For more information, see our shipping policy
SKU: P2020-164 trenzyme
Description
Programmed death ligand 1 (PD-L1) is considered as crucial immune checkpoint regulator with significant implications in cancer and autoimmune diseases. Binding to its receptor, programmed cell death protein 1 (PD-1), provides inhibitory signals that modulate T cell activation and ensure maintenance of peripheral tolerance. Cancer cells often exploit the PD-L1/PD-1 pathway to evade immune surveillance. Overexpression of PD-L1 allows cancer cells to inhibit anti-tumor immune responses, leading to immune escape and tumor progression. PD-L1 expression in the tumor microenvironment has become a critical biomarker for predicting responses to immunotherapy.
Overview
-
Product Name: human PD-L1, His-Tag
-
Catalog No.: P2020-164
-
RefSeq Links: HGNC:17635; NX_Q9NZQ7; NP_054862.1; NM_014143.3; PDBe 7xae; UniProt: Q9NZQ7
-
Synonyms: Programmed cell death 1 ligand 1, PDCD1 ligand 1, Programmed death ligand 1, hPD-L1, B7 homolog 1, B7-H1, CD274, B7H1, PDCD1L1, PDCD1LG1, PDL1
Customer Testimonial
“We highly valued the fast and excellent communication and the high flexibility of the team! For any future project, we will preferably entrust in trenzyme’s protein production services.”
Dr. Thore Hettmann
Probiodrug AG, Halle/Saale, Germany
Sequence Information
- Species: Homo sapiens
- Tags: His-tag, C-terminal
-
Sequence without tags (AA 19-239):
MFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQ
HSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKI
NQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTL
RINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERT
Product Information
-
Expression Host: HEK293
-
Formulation: PBS; pH 7.4
- Format: Liquid, stored and shipped at -80° C
-
Purity: > 95 % as determined by SDS-PAGE
- Application: ELISA, WB, Functional assay
Background Information
Programmed death ligand 1 (PD-L1), also known as B7 homolog 1 (B7-H1), is a transmembrane glycoprotein, which belongs to the B7 family of immune molecules and plays a pivotal role in regulating adaptive immune responses. Various stimuli, including inflammatory signals and interferon-gamma (IFN-ɣ), induce the expression of PD-L1 on antigen-presenting cells (APCs), such as dendritic cells, macrophages and B cells in peripheral tissues, as well as on epithelial and vascular endothelial cells. Its receptor, programmed cell death protein 1 (PD-1), which is expressed on activated T cells, recognizes PD-L1. This interaction serves as negative feedback mechanism to modulate T cell activation and to prevent excessive immune responses, contributing to immune homeostasis. Apparently, dysregulation of PD-L1 expression or function leads to the development of autoimmune diseases, such as rheumatoid arthritis. Tumor cells evade immune surveillance due to overexpression of PD-L1 on various cancer cell types. This enables inhibition of anti-tumor immune responses and promotes tumor growth and progression. PD-L1 expression in the tumor microenvironment has become a critical biomarker for predicting responses to immunotherapy. Immune checkpoint inhibition using monoclonal antibodies blocking the PD-1/PD-L1 interaction has emerged as excellent therapeutic strategy in cancer therapy. Further insights into PD-L1 biology will likely lead to improved treatment modalities and expanded applications in the field of immune-mediated diseases.
SDS-PAGE/Coll. Coomassie |
Histogram of marked lane in gel picture |