human IL-10
€99.00
Price excl. shipping costs excl. VAT. For more information, see our shipping policy
SKU: P2020-146 trenzyme
Description
The anti-inflammatory cytokine interleukin-10 (IL-10) plays a crucial role in regulating innate and adaptive immune responses in order to prevent chronic inflammation and tissue damage. IL-10 is produced by a variety of different cell types, including macrophages, dendritic cells (DCs), effector T lymphocytes, regulatory B cells and epithelial cells. Expression of IL-10 is tightly controlled to ensure efficient eradication of pathogens while reducing pathologic inflammation. Moreover, IL-10 is associated with autoimmune diseases, including multiple sclerosis and systemic lupus erythematosus, as well as several types of cancer.
human IL-10 is available with His-tag or Tag-free. The tag and size can be selected by using the buttons.
Â
Overview
-
Product Name:Â human IL-10
-
Catalog No.: P2020-144 His-tag; P2020-146 Tag-free
- RefSeq Links: HGNC:5962; NX_P22301; NP_000563.1; NM_000572.2; PDBe 2ilk; UniProt: P22301
-
Synonyms: Interleukin 10, IL-10, IL10, Cytokine synthesis inhibitory factor (CSIF), CSIF Protein, TGIF Protein, GVHDS
Customer Testimonial
“We highly valued the fast and excellent communication and the high flexibility of the team! For any future project, we will preferably entrust in trenzyme’s protein production services.”
Dr. Thore Hettmann
Probiodrug AG, Halle/Saale, Germany
Sequence Information
- Species: Homo sapiens
-
Tags:Â
P2020-144:Â His-tag, N-terminal
P2020-146: Tag-free; His-tag removed by proteolytic digest -
Sequence without tags (AA 19-178):
MSPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGY
LGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSK
AVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN
Product Information
-
Expression Host: HEK293
-
Formulation: PBS; pH 7.4
- Format: Liquid, stored and shipped at -80 °C
-
Purity: > 90% as determined by SDS-PAGE
- Application:Â ELISA, WB, Functional assay
Background Information
Interleukin-10 (IL-10) is a cytokine that plays a crucial role in the regulation of both innate and adaptive immune responses and controls inflammatory processes. It was first identified in the early 1990s and has since been extensively studied for its immunoregulatory functions. IL-10 is produced by various immune cells, including effector T cells, B cells, classically and especially alternatively activated macrophages, dendritic cells (DCs), as well as certain non-immune cells.
IL-10 is often referred to as an "anti-inflammatory cytokine" because of its ability to suppress inflammation. It inhibits the production of pro-inflammatory cytokines like interleukin-1 (IL-1), interleukin-6 (IL-6), interleukin-12 (IL-12) and tumor necrosis factor-alpha (TNF-α). Moreover, IL-10 suppresses expression of MHC class II and costimulatory molecules B7-1/B7-2 on monocytes and macrophages, thereby impeding T cell activation and differentiation in the lymph nodes.
IL-10 is both produced by macrophages and DCs and inhibits their function by suppressing production of inflammatory cytokines indicating a sophisticated negative feedback mechanism that limits potential damage to tissues.
The non-covalently associated homodimer IL-10 binds to the type II cytokine receptor IL-10 consisting of two IL-10 R alpha chains. Binding results in the recruitment of two IL-10 R beta chains, which are essential for signal transduction. Signaling induces activation of Janus Kinase 1 (JAK1), Tyrosine Kinase 2 (TYK2), and the transcription factor STAT3.
Dysregulation of IL-10 is implicated in various diseases. For example, deficient IL-10 production or function is associated with inflammatory bowel diseases (IBD) like Crohn's disease and ulcerative colitis. Conversely, excessive IL-10 production can contribute to immune evasion by certain pathogens and promote the survival of cancer cells by suppressing anti-tumor immune responses.
Noteworthy, while human IL-10 is able to activate also murine cells, murine IL-10 is inactive on human cells.
Â
Additional information human IL-10, His-tag:
SDS-PAGE/Coll. Coomassie |
Histogram of marked lane in gel picture |
Â
Additional information human IL-10, Tag-free:
SDS-PAGE/Coll. Coomassie |
Histogram of marked lane in gel picture |
Â